PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C021917P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 390aa    MW: 43455.2 Da    PI: 7.711
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C021917P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.51.1e-31251306156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k+r++W++eLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQk+Rl+
  MELO3C021917P1 251 KQRRCWSKELHRRFVSALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKFRLH 306
                     79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.01E-17248309IPR009057Homeodomain-like
PROSITE profilePS5129412.152248308IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-28249309IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-26251306IPR006447Myb domain, plants
PfamPF002491.6E-6253303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MGSLPSELSL DFRPTFVPKT ITDFFKEVSM IGNVSDRVSK LNDFIKSLED EMRKIDAFKR  60
ELPLCMILLQ DAILAVKDEK MQCAVLKTKP VLEEFIPLKK EQEEDDDDDS KKGNDCRDQK  120
NWMSSVQLWN SDDNHHSNYK LETKRNEKGG PVVTQVSLQS CRTKNGERMH VPFKPSYPMF  180
PSAMVVTKED KEEFPIHGLS LCTPGIKNPM EESASTGSRS SGTRAVSSST LTASVNLRTA  240
MQQQKQQCSR KQRRCWSKEL HRRFVSALQQ LGGSQVATPK QIRELMQVDG LTNDEVKSHL  300
QKFRLHARRL PASAVPPANQ SSVVVLGGLL VPQDAYADSS KACSSQSGSP QGPLQLAGTG  360
GDSMEEEDDV KSESYCWKSR IQKPGNEDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819140.0LN681914.1 Cucumis melo genomic scaffold, anchoredscaffold00050.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459219.10.0PREDICTED: uncharacterized protein LOC103498410
TrEMBLA0A0A0LIJ10.0A0A0A0LIJ1_CUCSA; Uncharacterized protein
STRINGVIT_03s0063g01060.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.16e-43G2-like family protein